PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29929.m004746
Common NameLOC8278469, RCOM_1082450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 507aa    MW: 56534.1 Da    PI: 7.2274
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29929.m004746genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.95.9e-1091355051374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfsh 95 
                    lv++L++cAeav+ +d++ a+alL++l+ +a   g+++qR+a++f+++L+ rl+  +  + +  l p  ++ + ++e+  al+l +e++P ++f++
  29929.m004746 135 LVQQLIACAEAVACRDKTHASALLSELRANALVFGTSFQRVASCFVQGLSDRLTLlQPLGAVGVLGPAGKTISFTAEKDEALRLVYEICPQIQFGY 230
                    689***************************************************94444556666677676667999999**************** PP

           GRAS  96 ltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                    ++aN +Ilea+ege+ +H++D++++    +G QW +Ll+ La+Rp+++p  lRiTgvg+    s+e+l+++g+ L  +A++lg++fef   v+++l
  29929.m004746 231 FVANATILEAFEGESSIHVVDLGMTlglpHGEQWRNLLHCLANRPDKKPrCLRITGVGN----SAERLQALGDELDCYARSLGLNFEFLW-VESSL 321
                    *********************98873333778*************655549********....9**************************.799** PP

           GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                    e+l+  ++++  gE++++n++lqlh  ++es    +   +vL+++ +lsPk++++veq++ hn++ Fl r++eal+yysa+fdsl++ lp+ + +r
  29929.m004746 322 EKLKSTDFKLLDGEVVIINSILQLHCAVKESRGALN---TVLQILHELSPKLLILVEQDSGHNGPFFLGRVMEALHYYSAIFDSLDTMLPKYDTKR 414
                    ****************************88887777...9******************************************************** PP

           GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +k+E+++ g+ei+n+v+ceg +r+erhe++ +Wr+r+++aGF+p++++  +a+qak  l k k  +gy+v e++g+l+lgWk++p++++S+W+
  29929.m004746 415 VKIEQFFYGEEIKNIVSCEGPARVERHERVDQWRRRMSRAGFQPAQIK--MAMQAKQWLGKAKvCEGYTVTEDKGCLILGWKSKPIIAASCWK 505
                    *********************************************996..689**********9****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.058109486IPR005202Transcription factor GRAS
PfamPF035142.1E-106135505IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MPSALYMQSE SFRDYTRYET TGLDLNIGYS IPHIPVSKNS RPTCFDLDET RSHKRVKPGG  60
VESIGNGIGC YAVSSNGGSI NANCLNSLPR LHFRDYIRAY TERYLAIEAM EEAAAGLMIS  120
KKNEIKEEDI DGMKLVQQLI ACAEAVACRD KTHASALLSE LRANALVFGT SFQRVASCFV  180
QGLSDRLTLL QPLGAVGVLG PAGKTISFTA EKDEALRLVY EICPQIQFGY FVANATILEA  240
FEGESSIHVV DLGMTLGLPH GEQWRNLLHC LANRPDKKPR CLRITGVGNS AERLQALGDE  300
LDCYARSLGL NFEFLWVESS LEKLKSTDFK LLDGEVVIIN SILQLHCAVK ESRGALNTVL  360
QILHELSPKL LILVEQDSGH NGPFFLGRVM EALHYYSAIF DSLDTMLPKY DTKRVKIEQF  420
FYGEEIKNIV SCEGPARVER HERVDQWRRR MSRAGFQPAQ IKMAMQAKQW LGKAKVCEGY  480
TVTEDKGCLI LGWKSKPIIA ASCWKCC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-501355054375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515010.10.0PREDICTED: DELLA protein GAI1
TrEMBLB9RMP10.0B9RMP1_RICCO; DELLA protein GAI1, putative
STRINGPOPTR_0012s09550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.13e-75GRAS family protein